(data stored in ACNUC7421 zone)

EMBL: CP002047.PE169

CP002047.PE169       Location/Qualifiers
FT   CDS             186000..186173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00169"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03290"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU9"
FT                   /protein_id="ADI03290.1"
FT                   /translation="MNTNTNTIVSRHTTSKGVVVWSRCACGRLQMALIPYGTDGKGLAA
FT                   GGHHIQCPHRGR"
     MNTNTNTIVS RHTTSKGVVV WSRCACGRLQ MALIPYGTDG KGLAAGGHHI QCPHRGR           57
//

If you have problems or comments...

PBIL Back to PBIL home page