(data stored in ACNUC7421 zone)

EMBL: CP002047.PE170

CP002047.PE170       Location/Qualifiers
FT   CDS             complement(186525..187712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00170"
FT                   /product="WD-40 repeat protein"
FT                   /note="COG2319 FOG: WD40 repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03291"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV0"
FT                   /protein_id="ADI03291.1"
FT                   /translation="MLGSASSPQARQAAAIYQASAHLHRDTDPVIRRQLLALDAARHGA
FT                   AELSDRLISSPVEGEPDAEWRVEWATGPSRLGHPTRPEDVAFTVATVAIDGRLHAVVGG
FT                   PDELVRIWDLATGEPVGEPLTGHETRVPAVATTVVDGCPYAVTGDMDGAVRVWNLTTGK
FT                   PVGEPLLGHDDEVNCVATALIDGRPHVVTVSEDETTWMWDLTTGEPVGDPLIDHEAGVP
FT                   AMATTTIDGHPHLVTGAFGGGVMVWDLGTGETARELNTGDRTNVMTVATTAIDGQPHAI
FT                   TTSYLDVVDPGDDDRLSLWDLTTGRQVADLEGDTDKVQAVATALIDGRPHAVTGGQRGR
FT                   RHPELRGTVRVRDVTTFRQAGRELLFPMPVHTVTVASNGWLIVGFGNEAAAFSRR"
     MLGSASSPQA RQAAAIYQAS AHLHRDTDPV IRRQLLALDA ARHGAAELSD RLISSPVEGE        60
     PDAEWRVEWA TGPSRLGHPT RPEDVAFTVA TVAIDGRLHA VVGGPDELVR IWDLATGEPV       120
     GEPLTGHETR VPAVATTVVD GCPYAVTGDM DGAVRVWNLT TGKPVGEPLL GHDDEVNCVA       180
     TALIDGRPHV VTVSEDETTW MWDLTTGEPV GDPLIDHEAG VPAMATTTID GHPHLVTGAF       240
     GGGVMVWDLG TGETARELNT GDRTNVMTVA TTAIDGQPHA ITTSYLDVVD PGDDDRLSLW       300
     DLTTGRQVAD LEGDTDKVQA VATALIDGRP HAVTGGQRGR RHPELRGTVR VRDVTTFRQA       360
     GRELLFPMPV HTVTVASNGW LIVGFGNEAA AFSRR                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page