(data stored in ACNUC7421 zone)

EMBL: CP002047.PE173

CP002047.PE173       Location/Qualifiers
FT   CDS             192471..193553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00173"
FT                   /product="hypothetical protein"
FT                   /note="COG2837 Predicted iron-dependent peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00173"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03294"
FT                   /db_xref="GOA:D7BUV3"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV3"
FT                   /protein_id="ADI03294.1"
FT                   /translation="MGARSREPVPQPVLSPLTAAAIFLVATIDQGGEPVTRELLSNLNG
FT                   LQRAVGFRATPDGRLSVVVGIGSQAWDRLFAGARPAELHTFRELTGPRHRAVSTPGDLL
FT                   FHIRATRLDLCFALAAEIMERLRGVVTVRDEVHGFKYFDVRDLLGFVDGTENPTGTAAS
FT                   AAVLIGDEDPQFASGSYVVVQRYVHDLQAWKALPVEAQEMVIGRRKLSDIELDDTVKPA
FT                   DSHVALTTIEDPDGTKHEILRDNMPFGTVGQGEFGTYFIGYARTPTVTERMLRRMFLGA
FT                   PPASHDRILDFSTPVTGSLFYVPSSDFLDDLPEPPGRSETADADTAAATARFPAVNGSL
FT                   GVGGLRKQQKASTADGQSAP"
     MGARSREPVP QPVLSPLTAA AIFLVATIDQ GGEPVTRELL SNLNGLQRAV GFRATPDGRL        60
     SVVVGIGSQA WDRLFAGARP AELHTFRELT GPRHRAVSTP GDLLFHIRAT RLDLCFALAA       120
     EIMERLRGVV TVRDEVHGFK YFDVRDLLGF VDGTENPTGT AASAAVLIGD EDPQFASGSY       180
     VVVQRYVHDL QAWKALPVEA QEMVIGRRKL SDIELDDTVK PADSHVALTT IEDPDGTKHE       240
     ILRDNMPFGT VGQGEFGTYF IGYARTPTVT ERMLRRMFLG APPASHDRIL DFSTPVTGSL       300
     FYVPSSDFLD DLPEPPGRSE TADADTAAAT ARFPAVNGSL GVGGLRKQQK ASTADGQSAP       360
//

If you have problems or comments...

PBIL Back to PBIL home page