(data stored in ACNUC7421 zone)

EMBL: CP002047.PE174

CP002047.PE174       Location/Qualifiers
FT   CDS             193534..194376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00174"
FT                   /product="antigen cfp29"
FT                   /note="COG1659 Uncharacterized protein, linocin/CFP29
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00174"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03295"
FT                   /db_xref="GOA:D7BUV4"
FT                   /db_xref="InterPro:IPR007544"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV4"
FT                   /protein_id="ADI03295.1"
FT                   /translation="MDNLHRELAPISAVAWADMEQEARRTFERHVAGRRIVDVPEPCGT
FT                   ELSGVGTGHLEAAEAPADGITAHRRAFQPLVELRVPFTVDRQQVDDVERGAKDTDWQPV
FT                   QDAARDIAFAEDRTVFEGYAAAGIAGLRSSSSNQALTMPAEVRDYPTVVSKAVSALRLA
FT                   GVGGPYAMALSVEAYTAVSGTSDYGYPVIKHMARVLGGDIVWAPAIDGAFLLSARGGDF
FT                   ELRIGQDVSIGYLSHDERSIRLYFQETLTFLVYTSEAVVPVEVAAPRPIEPPEVQTRR"
     MDNLHRELAP ISAVAWADME QEARRTFERH VAGRRIVDVP EPCGTELSGV GTGHLEAAEA        60
     PADGITAHRR AFQPLVELRV PFTVDRQQVD DVERGAKDTD WQPVQDAARD IAFAEDRTVF       120
     EGYAAAGIAG LRSSSSNQAL TMPAEVRDYP TVVSKAVSAL RLAGVGGPYA MALSVEAYTA       180
     VSGTSDYGYP VIKHMARVLG GDIVWAPAID GAFLLSARGG DFELRIGQDV SIGYLSHDER       240
     SIRLYFQETL TFLVYTSEAV VPVEVAAPRP IEPPEVQTRR                             280
//

If you have problems or comments...

PBIL Back to PBIL home page