(data stored in ACNUC7421 zone)

EMBL: CP002047.PE177

CP002047.PE177       Location/Qualifiers
FT   CDS             complement(196145..196615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00177"
FT                   /product="putative DNA-binding protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00177"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03298"
FT                   /db_xref="GOA:D7BUV7"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV7"
FT                   /protein_id="ADI03298.1"
FT                   /translation="MRDAADTVDKHGGPNIARYIFLDPGAQDFFVDWDTAATATAALLR
FT                   PEAGREPRDRALRELIGELSTLSPDFRASWAMHDVRIRHDGIKRLWHPDVGELELRYHS
FT                   LDLPVSNRAVHDLTLYTAEPGTTSEDRLKLLASLAASQPHSAEPISPKSPPS"
     MRDAADTVDK HGGPNIARYI FLDPGAQDFF VDWDTAATAT AALLRPEAGR EPRDRALREL        60
     IGELSTLSPD FRASWAMHDV RIRHDGIKRL WHPDVGELEL RYHSLDLPVS NRAVHDLTLY       120
     TAEPGTTSED RLKLLASLAA SQPHSAEPIS PKSPPS                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page