(data stored in ACNUC7421 zone)

EMBL: CP002047.PE18

CP002047.PE18        Location/Qualifiers
FT   CDS             complement(14972..15466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00018"
FT                   /product="hypothetical protein"
FT                   /note="COG5659 FOG: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00018"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03139"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW2"
FT                   /protein_id="ADI03139.1"
FT                   /translation="MRDYVRGLLGPVGRKNSWQLAEQAGHTTPDGLRRLLAGARWDPDQ
FT                   VRDGLQDYVAERLGCPDGVLIIDDTGFLKKGTTSAGVQRQYSGTARRTENCQIGVFAAY
FT                   ASVKGRALVDRELYLPSPGGMIWSGAGPRRSRRIGRSRPSPSSPGGWSRAHWPRRCPWR
FT                   G"
     MRDYVRGLLG PVGRKNSWQL AEQAGHTTPD GLRRLLAGAR WDPDQVRDGL QDYVAERLGC        60
     PDGVLIIDDT GFLKKGTTSA GVQRQYSGTA RRTENCQIGV FAAYASVKGR ALVDRELYLP       120
     SPGGMIWSGA GPRRSRRIGR SRPSPSSPGG WSRAHWPRRC PWRG                        164
//

If you have problems or comments...

PBIL Back to PBIL home page