(data stored in ACNUC7421 zone)

EMBL: CP002047.PE181

CP002047.PE181       Location/Qualifiers
FT   CDS             199693..201312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00181"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03302"
FT                   /db_xref="GOA:D7BUW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUW1"
FT                   /protein_id="ADI03302.1"
FT                   /translation="MPTQITALAVSKSFNGRLVLDSVTCSLTAGERTGIIGENGSGKTT
FT                   LLRLLAGRERPDQGEVVVQATGGVGYLAQNERMEPQTTVQQIIDRALSELRTVEQRMRR
FT                   LEAAMADGDESGMAEYGELMTVFELRGGYDADARVERALHGLGLGLVARDRTVGSLSGG
FT                   ERVRLRLAAVLAAAPEVLLLDEPTNHLDDAALSWLEEHLRTRRGTTVAVSHDRVFIERV
FT                   ATSLLEVDADRRRVVRYGNGYSGYLAEKAAARQRWAQAHHQWRADIDRLREAAATTARQ
FT                   VAPGRPMKDGNKMAYDRAAGRVQQSLAARVRNAEERLRRLLTDPVPPPPEPLRFTPVLR
FT                   TRRLQGAVLDAADIAVTDRLDRTSLTVKAGERLLITGPNGAGKSTLLRVLAGEVTPDNG
FT                   SVTRRARIGYLPQEPHPGTPDETVLAAFARGRAGEAAGYAERLLSLGLFDREQLTVPVG
FT                   RLSTGQLQRLALARLLSEPSDVLLLDEPTNHVSPSLVEELETALTGYDGALVIVSHDRR
FT                   LRRRWRGTHLAMQPTPTPAARV"
     MPTQITALAV SKSFNGRLVL DSVTCSLTAG ERTGIIGENG SGKTTLLRLL AGRERPDQGE        60
     VVVQATGGVG YLAQNERMEP QTTVQQIIDR ALSELRTVEQ RMRRLEAAMA DGDESGMAEY       120
     GELMTVFELR GGYDADARVE RALHGLGLGL VARDRTVGSL SGGERVRLRL AAVLAAAPEV       180
     LLLDEPTNHL DDAALSWLEE HLRTRRGTTV AVSHDRVFIE RVATSLLEVD ADRRRVVRYG       240
     NGYSGYLAEK AAARQRWAQA HHQWRADIDR LREAAATTAR QVAPGRPMKD GNKMAYDRAA       300
     GRVQQSLAAR VRNAEERLRR LLTDPVPPPP EPLRFTPVLR TRRLQGAVLD AADIAVTDRL       360
     DRTSLTVKAG ERLLITGPNG AGKSTLLRVL AGEVTPDNGS VTRRARIGYL PQEPHPGTPD       420
     ETVLAAFARG RAGEAAGYAE RLLSLGLFDR EQLTVPVGRL STGQLQRLAL ARLLSEPSDV       480
     LLLDEPTNHV SPSLVEELET ALTGYDGALV IVSHDRRLRR RWRGTHLAMQ PTPTPAARV        539
//

If you have problems or comments...

PBIL Back to PBIL home page