(data stored in ACNUC7421 zone)

EMBL: CP002047.PE183

CP002047.PE183       Location/Qualifiers
FT   CDS             202122..203420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00183"
FT                   /product="erythromycin esterase-like protein"
FT                   /note="COG2312 Erythromycin esterase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00183"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03304"
FT                   /db_xref="GOA:D7BWE8"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="InterPro:IPR016273"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWE8"
FT                   /protein_id="ADI03304.1"
FT                   /translation="MPASPHHNPFADWLRTHAVPLTHLDPEAPLDDLEPLRTIIGDARV
FT                   VAIGENSHFINEFAILRERVLRFLVERCGFTVLAFEYGFSEGFPLDAWAQGEGTDDDLS
FT                   AHLAATIPIGVEEPLRWMRRHNRTTSPPVRFAGIDLPAAGGSLLPALTPVADYLRHIDP
FT                   ETLPMVQTAMRIAESFAGGSAADAAPAWARLATAEQDTLSATLMRLLMRFRSVEPLYVS
FT                   RGDQQSHDIALRRLEGACRGDYTFRAMADLFAGKGLTADTSARDVYMAESVLWHLERFE
FT                   PGTRVVLAAHNAHIQKTSVSFNGHLTGLPMGQHLHRALGDEYVALGLTSITGDTADMRR
FT                   DENARFGFAIDTTALEPPEPGSIEAAFADAELGLSIADFHQARPEARDSAGLAQGPDRI
FT                   RIQSAYLHTPILEAFDAILNTPASTVADNLENT"
     MPASPHHNPF ADWLRTHAVP LTHLDPEAPL DDLEPLRTII GDARVVAIGE NSHFINEFAI        60
     LRERVLRFLV ERCGFTVLAF EYGFSEGFPL DAWAQGEGTD DDLSAHLAAT IPIGVEEPLR       120
     WMRRHNRTTS PPVRFAGIDL PAAGGSLLPA LTPVADYLRH IDPETLPMVQ TAMRIAESFA       180
     GGSAADAAPA WARLATAEQD TLSATLMRLL MRFRSVEPLY VSRGDQQSHD IALRRLEGAC       240
     RGDYTFRAMA DLFAGKGLTA DTSARDVYMA ESVLWHLERF EPGTRVVLAA HNAHIQKTSV       300
     SFNGHLTGLP MGQHLHRALG DEYVALGLTS ITGDTADMRR DENARFGFAI DTTALEPPEP       360
     GSIEAAFADA ELGLSIADFH QARPEARDSA GLAQGPDRIR IQSAYLHTPI LEAFDAILNT       420
     PASTVADNLE NT                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page