(data stored in ACNUC7421 zone)

EMBL: CP002047.PE184

CP002047.PE184       Location/Qualifiers
FT   CDS             204810..205736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00184"
FT                   /product="hypothetical protein"
FT                   /note="COG0405 Gamma-glutamyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00184"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03305"
FT                   /db_xref="InterPro:IPR026935"
FT                   /db_xref="InterPro:IPR032369"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWE9"
FT                   /protein_id="ADI03305.1"
FT                   /translation="MLLRHQGLDLSEPMLFGLGSGLSFIYWDSKNMGFPFLGGRVKPFD
FT                   LTTNLATGLGLELLVQETTSPRKAWENVVAPIDAGHPVGLQLDSYHLDYFGTKVHFGGH
FT                   VVAMYGYDDRDAYLVDTDQQGGTVSTSLTSLAQARAARGPMTAKHRSFTLTVPSDLPSP
FT                   QSQIIPAITACADAFLNPPIANLGHRGIEKTGKLVRTWLQRTDNPQRDLPQAALLMEKA
FT                   GTGGALFRNLYRDFLAECTQHLDSSHLRTGHGLYTEAAALWTEAAALITRAGQSADAQC
FT                   LVQAGTVLRDLSRIEREAMQALSRLGQ"
     MLLRHQGLDL SEPMLFGLGS GLSFIYWDSK NMGFPFLGGR VKPFDLTTNL ATGLGLELLV        60
     QETTSPRKAW ENVVAPIDAG HPVGLQLDSY HLDYFGTKVH FGGHVVAMYG YDDRDAYLVD       120
     TDQQGGTVST SLTSLAQARA ARGPMTAKHR SFTLTVPSDL PSPQSQIIPA ITACADAFLN       180
     PPIANLGHRG IEKTGKLVRT WLQRTDNPQR DLPQAALLME KAGTGGALFR NLYRDFLAEC       240
     TQHLDSSHLR TGHGLYTEAA ALWTEAAALI TRAGQSADAQ CLVQAGTVLR DLSRIEREAM       300
     QALSRLGQ                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page