(data stored in ACNUC7421 zone)

EMBL: CP002047.PE186

CP002047.PE186       Location/Qualifiers
FT   CDS             complement(206941..207465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00186"
FT                   /product="hypothetical protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00186"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03307"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF1"
FT                   /protein_id="ADI03307.1"
FT                   /translation="MRLNPYGEDAVNLAAALANRRPESADELADRCRAAGLTLERPVTA
FT                   DDLDRARAALNAWERVVDAAGEQERADLLNRMLAEAAAYPRLTSHSGTGWHLHYRDAEQ
FT                   PLGSVLFTLFAVGTALHLAGRGMHRLRRCEVAECDTAFADTSRTGRQRYCSQRCANRDA
FT                   VRRHRARAAVT"
     MRLNPYGEDA VNLAAALANR RPESADELAD RCRAAGLTLE RPVTADDLDR ARAALNAWER        60
     VVDAAGEQER ADLLNRMLAE AAAYPRLTSH SGTGWHLHYR DAEQPLGSVL FTLFAVGTAL       120
     HLAGRGMHRL RRCEVAECDT AFADTSRTGR QRYCSQRCAN RDAVRRHRAR AAVT             174
//

If you have problems or comments...

PBIL Back to PBIL home page