(data stored in ACNUC7421 zone)

EMBL: CP002047.PE189

CP002047.PE189       Location/Qualifiers
FT   CDS             complement(210017..210754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00189"
FT                   /product="NIPSNAP family containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00189"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03310"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF4"
FT                   /protein_id="ADI03310.1"
FT                   /translation="MSPTDPVGRPAVIELRQYTLRPGRRDELIELFDREFVETQEETGM
FT                   VVLGQFRDLDDPNRFVWLRGFPDMAVRHRALTAFYGGPVWAEHGPQANDTMVDSDDVLL
FT                   LRPLSDGSGFAVSPSERPQAGAPAPDRFVSATVWSFPPGRPDGIALIRDGLLPVLHKTG
FT                   PAPLAVLTTETAHNTFARLPVRTGENVAAVFTSYPDESAYRRHLAEVQDHPLTREILPG
FT                   IEREQTAAPRTLRLAPTGRSLIS"
     MSPTDPVGRP AVIELRQYTL RPGRRDELIE LFDREFVETQ EETGMVVLGQ FRDLDDPNRF        60
     VWLRGFPDMA VRHRALTAFY GGPVWAEHGP QANDTMVDSD DVLLLRPLSD GSGFAVSPSE       120
     RPQAGAPAPD RFVSATVWSF PPGRPDGIAL IRDGLLPVLH KTGPAPLAVL TTETAHNTFA       180
     RLPVRTGENV AAVFTSYPDE SAYRRHLAEV QDHPLTREIL PGIEREQTAA PRTLRLAPTG       240
     RSLIS                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page