(data stored in ACNUC7421 zone)

EMBL: CP002047.PE19

CP002047.PE19        Location/Qualifiers
FT   CDS             complement(15555..18362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00019"
FT                   /product="DEAD/DEAH box helicase domain-containing protein"
FT                   /note="COG1204 Superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00019"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03140"
FT                   /db_xref="GOA:D7BSW3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW3"
FT                   /protein_id="ADI03140.1"
FT                   /translation="MTVTAISPAGPAASFARQPAPAWPPDLPLPAETEKRALLWCKATD
FT                   PNWRPSEQALAAAEDIRVIVPTSPDFDPLRTFLAEHGVPVRSAGHWAETEQVSTVGDLG
FT                   SRTDLVAFTSITGSVPSAPAAGPAAYAARDAFAAQWDALADLPPDEAAAYVPVTGLVPG
FT                   DWKELLPHPAFNPVQAAAVPAVLESDQHLVIVAPTGAGKTAIGMVAALQAHTRGRKAAW
FT                   LVPQRSLTDELDRDLETWRRAGRRVVRLTGEYAVDTELIRTADLWVATTEKFEAISRTG
FT                   SLRAALAEVGCLIVDEIHLLGDPTRGPVLEALLARVREDSAQVRIAGLSATVANAGQVA
FT                   DWLGARLIRSPWRPTRLTWQLPVLPNAADAPEWNARAQARTAEAVRLTRAITTTGGSVL
FT                   VFCGSKRGVRATALALAADRGVPTRGADTDDSELVERLCTRAGVRLHYRDWPYKRESEH
FT                   AFRTRQADILVATSTVAAGVNLPARAVIVRDTQVGMDRIEVSMVQQMFGRAGRVGAGER
FT                   EGWAYLLTSPTERAPWQARLAAGYTVTSRIRDHLPDHVLAEAVQGRLRDLDQAELWWTK
FT                   TFAHYQGHHHLDPLHDALDFLNDAGYLHRTPDPGGNDNLTITETGKLTSRFMVEADTAT
FT                   TLTDTLQLLPVPGSPDEAENTLITLLSTHLPALEQAPFTERAKTALYQVLRAGGHTDAA
FT                   HAPQPPGEDEDKPAAGDLARAVLLLVANSPKAFRTRSSYILGIPVDSMAQILDEARRYL
FT                   AWIAAQGHLGTIHPWAAITASDLAQRIRWRTLGPRRGSGRLLWMCERMATPAHVHRLVP
FT                   TMWRAARDRGIDAPDWPGTTSPSTCRLHPDDYRALLATRTTGIDLETRPDGIRVHAPRG
FT                   TVIHLWTDATVARHTADGTTCELPYPAPLPSHDAQVEHGGAVFTRGDYLVTGWLSAYNS
FT                   IAPRA"
     MTVTAISPAG PAASFARQPA PAWPPDLPLP AETEKRALLW CKATDPNWRP SEQALAAAED        60
     IRVIVPTSPD FDPLRTFLAE HGVPVRSAGH WAETEQVSTV GDLGSRTDLV AFTSITGSVP       120
     SAPAAGPAAY AARDAFAAQW DALADLPPDE AAAYVPVTGL VPGDWKELLP HPAFNPVQAA       180
     AVPAVLESDQ HLVIVAPTGA GKTAIGMVAA LQAHTRGRKA AWLVPQRSLT DELDRDLETW       240
     RRAGRRVVRL TGEYAVDTEL IRTADLWVAT TEKFEAISRT GSLRAALAEV GCLIVDEIHL       300
     LGDPTRGPVL EALLARVRED SAQVRIAGLS ATVANAGQVA DWLGARLIRS PWRPTRLTWQ       360
     LPVLPNAADA PEWNARAQAR TAEAVRLTRA ITTTGGSVLV FCGSKRGVRA TALALAADRG       420
     VPTRGADTDD SELVERLCTR AGVRLHYRDW PYKRESEHAF RTRQADILVA TSTVAAGVNL       480
     PARAVIVRDT QVGMDRIEVS MVQQMFGRAG RVGAGEREGW AYLLTSPTER APWQARLAAG       540
     YTVTSRIRDH LPDHVLAEAV QGRLRDLDQA ELWWTKTFAH YQGHHHLDPL HDALDFLNDA       600
     GYLHRTPDPG GNDNLTITET GKLTSRFMVE ADTATTLTDT LQLLPVPGSP DEAENTLITL       660
     LSTHLPALEQ APFTERAKTA LYQVLRAGGH TDAAHAPQPP GEDEDKPAAG DLARAVLLLV       720
     ANSPKAFRTR SSYILGIPVD SMAQILDEAR RYLAWIAAQG HLGTIHPWAA ITASDLAQRI       780
     RWRTLGPRRG SGRLLWMCER MATPAHVHRL VPTMWRAARD RGIDAPDWPG TTSPSTCRLH       840
     PDDYRALLAT RTTGIDLETR PDGIRVHAPR GTVIHLWTDA TVARHTADGT TCELPYPAPL       900
     PSHDAQVEHG GAVFTRGDYL VTGWLSAYNS IAPRA                                  935
//

If you have problems or comments...

PBIL Back to PBIL home page