(data stored in ACNUC7421 zone)

EMBL: CP002047.PE190

CP002047.PE190       Location/Qualifiers
FT   CDS             210902..211867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00190"
FT                   /product="helix-turn-helix type 11 domain protein"
FT                   /note="COG2378 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03311"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF5"
FT                   /protein_id="ADI03311.1"
FT                   /translation="MLSLLLLLQSRGRMSARGVADELGVSVRTAYRDLARLQAAGVPVY
FT                   AEPGRGGGYQLLDGYRTRLTGMSEGEARALFFAGLPGPAADLGLAAEVTAARLKLLAAL
FT                   PTGLREEAARTAAVFHLDAPGWYREPEQTPQLPLFVDAVLTGRAVDVRYRRWRAPQEVN
FT                   RRLRPYGLVLKSGTWYLVAAATDSRIATYRVTQVLDAVLSDERFDRPQGFDLGAYWTSY
FT                   LDDFQARRYTGTATIRLSPQGRRRLPDNVPPEVVRAVDSTATAVGDDGWVEAVIPTEST
FT                   YHACGELLRLGVDVEVVAPAELRQAMVATVGVLARAYGLH"
     MLSLLLLLQS RGRMSARGVA DELGVSVRTA YRDLARLQAA GVPVYAEPGR GGGYQLLDGY        60
     RTRLTGMSEG EARALFFAGL PGPAADLGLA AEVTAARLKL LAALPTGLRE EAARTAAVFH       120
     LDAPGWYREP EQTPQLPLFV DAVLTGRAVD VRYRRWRAPQ EVNRRLRPYG LVLKSGTWYL       180
     VAAATDSRIA TYRVTQVLDA VLSDERFDRP QGFDLGAYWT SYLDDFQARR YTGTATIRLS       240
     PQGRRRLPDN VPPEVVRAVD STATAVGDDG WVEAVIPTES TYHACGELLR LGVDVEVVAP       300
     AELRQAMVAT VGVLARAYGL H                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page