(data stored in ACNUC7421 zone)

EMBL: CP002047.PE192

CP002047.PE192       Location/Qualifiers
FT   CDS             complement(213217..213702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00192"
FT                   /product="transcriptional regulator, XRE family protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00192"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03313"
FT                   /db_xref="GOA:D7BWF7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF7"
FT                   /protein_id="ADI03313.1"
FT                   /translation="MSGSELARRAGLSKATLSQLEAGKGNPTIETLDALAIALRIPLTD
FT                   LLTRDTDPGPVFVAGTDLAEDEVGRELLRRISSGHSLEIWRLRMPVRTELAGVPHATGT
FT                   VEHLLVATGRLTAGPIDSPRLLGPGDLLAFAGDAPHIYRTDTEPADVTVVIASPIVS"
     MSGSELARRA GLSKATLSQL EAGKGNPTIE TLDALAIALR IPLTDLLTRD TDPGPVFVAG        60
     TDLAEDEVGR ELLRRISSGH SLEIWRLRMP VRTELAGVPH ATGTVEHLLV ATGRLTAGPI       120
     DSPRLLGPGD LLAFAGDAPH IYRTDTEPAD VTVVIASPIV S                           161
//

If you have problems or comments...

PBIL Back to PBIL home page