(data stored in ACNUC7421 zone)

EMBL: CP002047.PE193

CP002047.PE193       Location/Qualifiers
FT   CDS             complement(213786..214478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00193"
FT                   /product="predicted metal-dependent hydrolase"
FT                   /note="COG2872 Predicted metal-dependent hydrolases related
FT                   to alanyl-tRNA synthetase HxxxH domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00193"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03314"
FT                   /db_xref="GOA:D7BWF8"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF8"
FT                   /protein_id="ADI03314.1"
FT                   /translation="MQVRTYLDDTYAEQVDARVIAVGRREGRPWAAVEHCLFHPQGGGQ
FT                   PADRGWLEEVEVVPVRDEQSGLIVAVPAAAEAGWPVFAEGQPVRARIDLGARMAHAALH
FT                   TAGHLVEAAGRAQGCELAGNNHFPGQARIEFTAPQHDPRAAEPEGREEVLTELRKTVAA
FT                   AIAEDLPVTAAVDEQGLRMVSLGALHSAPCGGTHVRGLGDLHDVVLPSLKVKRGRIRVS
FT                   YSAAHGER"
     MQVRTYLDDT YAEQVDARVI AVGRREGRPW AAVEHCLFHP QGGGQPADRG WLEEVEVVPV        60
     RDEQSGLIVA VPAAAEAGWP VFAEGQPVRA RIDLGARMAH AALHTAGHLV EAAGRAQGCE       120
     LAGNNHFPGQ ARIEFTAPQH DPRAAEPEGR EEVLTELRKT VAAAIAEDLP VTAAVDEQGL       180
     RMVSLGALHS APCGGTHVRG LGDLHDVVLP SLKVKRGRIR VSYSAAHGER                  230
//

If you have problems or comments...

PBIL Back to PBIL home page