(data stored in ACNUC7421 zone)

EMBL: CP002047.PE194

CP002047.PE194       Location/Qualifiers
FT   CDS             complement(214614..214970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00194"
FT                   /product="hypothetical protein"
FT                   /note="COG4332 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00194"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03315"
FT                   /db_xref="InterPro:IPR009412"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF9"
FT                   /protein_id="ADI03315.1"
FT                   /translation="MNVRSVRPELLDRLHDNDPGLTAELLQDPVVQRRNRIALDWDNAW
FT                   RLDTGGSDHLDREVIDVSVRFAVRIPVRPVRLIAEGCGLSRAEVERLITEGKLVSAVRL
FT                   SGKLCGDFTFTLKR"
     MNVRSVRPEL LDRLHDNDPG LTAELLQDPV VQRRNRIALD WDNAWRLDTG GSDHLDREVI        60
     DVSVRFAVRI PVRPVRLIAE GCGLSRAEVE RLITEGKLVS AVRLSGKLCG DFTFTLKR         118
//

If you have problems or comments...

PBIL Back to PBIL home page