(data stored in ACNUC7421 zone)

EMBL: CP002047.PE198

CP002047.PE198       Location/Qualifiers
FT   CDS             complement(217736..218227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00198"
FT                   /product="hypothetical protein"
FT                   /note="COG2606 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00198"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03319"
FT                   /db_xref="GOA:D7BWG3"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG3"
FT                   /protein_id="ADI03319.1"
FT                   /translation="MASQESTSLPVRSMQVARALAAAGIAGQVRELTESARTAAEAASA
FT                   LGCDVGAIANSLVFISDDEPVLVMTSGRHRVDTTALAARWGRGRLRRATAEQVRQATGQ
FT                   AIGGVAPVGHPRALPAVVDEALTDYSQVWAAGGTPHTIFPTTAGELVQLTGGLLLPVGP
FT                   "
     MASQESTSLP VRSMQVARAL AAAGIAGQVR ELTESARTAA EAASALGCDV GAIANSLVFI        60
     SDDEPVLVMT SGRHRVDTTA LAARWGRGRL RRATAEQVRQ ATGQAIGGVA PVGHPRALPA       120
     VVDEALTDYS QVWAAGGTPH TIFPTTAGEL VQLTGGLLLP VGP                         163
//

If you have problems or comments...

PBIL Back to PBIL home page