(data stored in ACNUC7421 zone)

EMBL: CP002047.PE199

CP002047.PE199       Location/Qualifiers
FT   CDS             218349..218867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00199"
FT                   /product="putative transcriptional regulator, XRE family
FT                   protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00199"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03320"
FT                   /db_xref="GOA:D7BWG4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG4"
FT                   /protein_id="ADI03320.1"
FT                   /translation="MDLAARVGLRLRELREAQDLSLSELARRSAIGKGTLSELEGGRRN
FT                   PTLETLYALTTALNVPLSTALHGLALPAEISGRAVDAVLTERFEDASAVTETYRIRIRA
FT                   GTTQESAAHSPGTTEHIVVLAGTARVGSLSAPVSIGPGMHGSWAADVPHLYQAPFGDVE
FT                   ALLVVRHPQ"
     MDLAARVGLR LRELREAQDL SLSELARRSA IGKGTLSELE GGRRNPTLET LYALTTALNV        60
     PLSTALHGLA LPAEISGRAV DAVLTERFED ASAVTETYRI RIRAGTTQES AAHSPGTTEH       120
     IVVLAGTARV GSLSAPVSIG PGMHGSWAAD VPHLYQAPFG DVEALLVVRH PQ               172
//

If you have problems or comments...

PBIL Back to PBIL home page