(data stored in ACNUC7421 zone)

EMBL: CP002047.PE201

CP002047.PE201       Location/Qualifiers
FT   CDS             220745..222022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00201"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03322"
FT                   /db_xref="GOA:D7BWG6"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG6"
FT                   /protein_id="ADI03322.1"
FT                   /translation="MVTLGFFITLEIAARHYGLPGPMTTQAQEVIFAPKSGPLLYASMA
FT                   LMMVVLTWRQRFIALGAAIGIDVVFVLVRWAVGAKITEGHPFGNGALWVMLGYGVIAVT
FT                   RRTGRERALLLKGVGLGLLLVAGRKTGDTWLLITSKTRPTVLDEYVATADHALGNPSWL
FT                   VGRIVRATDPIGTHLLDWVYIQLAVAAVVVSLYQLRHVAVERRFPSHYLVRTFLVIGLV
FT                   GPAIYMIFPVVGPIFAYGPGAYGTGGLHWAVADLWPDTPPPLNPPHPVPYDDITPRNCM
FT                   PSLHTAWATAIFIHSRKGPRILRFAGTFWLIATLTATLGFGYHYGVDLIAGVVFTLTIE
FT                   AALRSHERGWDRSGLQLVAYGTAVFAALLVSYRYLPMEMAKYPWVFGPLLILAMTSVIY
FT                   AYVRTTKLWEQKTTPAPQPEPQPELV"
     MVTLGFFITL EIAARHYGLP GPMTTQAQEV IFAPKSGPLL YASMALMMVV LTWRQRFIAL        60
     GAAIGIDVVF VLVRWAVGAK ITEGHPFGNG ALWVMLGYGV IAVTRRTGRE RALLLKGVGL       120
     GLLLVAGRKT GDTWLLITSK TRPTVLDEYV ATADHALGNP SWLVGRIVRA TDPIGTHLLD       180
     WVYIQLAVAA VVVSLYQLRH VAVERRFPSH YLVRTFLVIG LVGPAIYMIF PVVGPIFAYG       240
     PGAYGTGGLH WAVADLWPDT PPPLNPPHPV PYDDITPRNC MPSLHTAWAT AIFIHSRKGP       300
     RILRFAGTFW LIATLTATLG FGYHYGVDLI AGVVFTLTIE AALRSHERGW DRSGLQLVAY       360
     GTAVFAALLV SYRYLPMEMA KYPWVFGPLL ILAMTSVIYA YVRTTKLWEQ KTTPAPQPEP       420
     QPELV                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page