(data stored in ACNUC7421 zone)

EMBL: CP002047.PE204

CP002047.PE204       Location/Qualifiers
FT   CDS             complement(223701..225917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00204"
FT                   /product="TPR repeat-containing protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00204"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03325"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG9"
FT                   /protein_id="ADI03325.1"
FT                   /translation="MLMLSGQAGVGKTALALRAAGEAVRRHWYVKGIYADVGRAAETSA
FT                   ETAVFTALGGLLHSLGVSEPQVAAVADGRVAQYRSVVSALAKRGKPVLVVLDSVSSLAE
FT                   AEPLLPPHPRNCAVVIGRHRLTGGGLAGACHHALGLFEPSEAVEFVVRALAAADEHDRR
FT                   AATDPEAVRALSMACGRLPLALDLAVGRLVTDRRMPVPTLADRLQDTPRPSAPEIQVDP
FT                   VRAVFARCCGRLPAGQARLLRLLSLYPGAHFGAEEAAALGGLPVAEAADVLMELSRARM
FT                   LAASGPRFGGHRFQGLLWSYATDLAQTEESCTQRKDAVERLLRFHVAATTEADTWLDPA
FT                   AAPAEGDRFTGVGEAVRWLDEHRPILIESVRTAIALGSHGLAVRLALGLTRYLELRDRT
FT                   ADRMTVLELAASAAHSAGDRGAEAECRRRLGHIHAQSYSASSALPYYGNAMTLFLLAGD
FT                   GSGAAAVVGDVLALLDRYRARERDTATLIIRYESGLAICRRGGDPAAVAAILDTLGNLH
FT                   QRTGAHHRAADCHAEALVLREQTHDVDGVAESLANLADAQRVGGDGQNAAANYERAAGL
FT                   SRDRGDSRREAQAWENLGLVHLRAGRMRPARQAFEHAAEVFNRGGPAQDAERVRGRLRQ
FT                   LRGWGSRRRAVDAARRQTAHAPDSQGVWRASGEGRHEGSAGTGARRPDRADADVSDVPD
FT                   TDGVIDFAVLWTVADFGLDYGDDTFDDGFGDDSDDSDDFGFDDD"
     MLMLSGQAGV GKTALALRAA GEAVRRHWYV KGIYADVGRA AETSAETAVF TALGGLLHSL        60
     GVSEPQVAAV ADGRVAQYRS VVSALAKRGK PVLVVLDSVS SLAEAEPLLP PHPRNCAVVI       120
     GRHRLTGGGL AGACHHALGL FEPSEAVEFV VRALAAADEH DRRAATDPEA VRALSMACGR       180
     LPLALDLAVG RLVTDRRMPV PTLADRLQDT PRPSAPEIQV DPVRAVFARC CGRLPAGQAR       240
     LLRLLSLYPG AHFGAEEAAA LGGLPVAEAA DVLMELSRAR MLAASGPRFG GHRFQGLLWS       300
     YATDLAQTEE SCTQRKDAVE RLLRFHVAAT TEADTWLDPA AAPAEGDRFT GVGEAVRWLD       360
     EHRPILIESV RTAIALGSHG LAVRLALGLT RYLELRDRTA DRMTVLELAA SAAHSAGDRG       420
     AEAECRRRLG HIHAQSYSAS SALPYYGNAM TLFLLAGDGS GAAAVVGDVL ALLDRYRARE       480
     RDTATLIIRY ESGLAICRRG GDPAAVAAIL DTLGNLHQRT GAHHRAADCH AEALVLREQT       540
     HDVDGVAESL ANLADAQRVG GDGQNAAANY ERAAGLSRDR GDSRREAQAW ENLGLVHLRA       600
     GRMRPARQAF EHAAEVFNRG GPAQDAERVR GRLRQLRGWG SRRRAVDAAR RQTAHAPDSQ       660
     GVWRASGEGR HEGSAGTGAR RPDRADADVS DVPDTDGVID FAVLWTVADF GLDYGDDTFD       720
     DGFGDDSDDS DDFGFDDD                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page