(data stored in ACNUC7421 zone)

EMBL: CP002047.PE205

CP002047.PE205       Location/Qualifiers
FT   CDS             complement(226213..226455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00205"
FT                   /product="hypothetical protein"
FT                   /note="COG0402 Cytosine deaminase and related
FT                   metal-dependent hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03326"
FT                   /db_xref="GOA:D7BWH0"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH0"
FT                   /protein_id="ADI03326.1"
FT                   /translation="MRTLLRGGKVVSMDPAVGDLPQGDVLIEDGRIAAVAATVDAADAE
FT                   VVDATGWIVMPGFVDTHRHTWQTAFQGWPRGVAVR"
     MRTLLRGGKV VSMDPAVGDL PQGDVLIEDG RIAAVAATVD AADAEVVDAT GWIVMPGFVD        60
     THRHTWQTAF QGWPRGVAVR                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page