(data stored in ACNUC7421 zone)

EMBL: CP002047.PE207

CP002047.PE207       Location/Qualifiers
FT   CDS             227950..228267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00207"
FT                   /product="transcriptional regulator, HxlR family protein"
FT                   /note="COG1733 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00207"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03328"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH2"
FT                   /protein_id="ADI03328.1"
FT                   /translation="MLVDLADKWVLLMLASLRESGVQRYSELQRSLGGISRKMLSQTLR
FT                   TLERDGLVLRTVDVKMAPPLVLYELTELGREIAEETRALCTWTEKRTATVYEARAAYDR
FT                   R"
     MLVDLADKWV LLMLASLRES GVQRYSELQR SLGGISRKML SQTLRTLERD GLVLRTVDVK        60
     MAPPLVLYEL TELGREIAEE TRALCTWTEK RTATVYEARA AYDRR                       105
//

If you have problems or comments...

PBIL Back to PBIL home page