(data stored in ACNUC7421 zone)

EMBL: CP002047.PE208

CP002047.PE208       Location/Qualifiers
FT   CDS             complement(228380..228997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00208"
FT                   /product="hypothetical protein"
FT                   /note="COG0655 Multimeric flavodoxin WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00208"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03329"
FT                   /db_xref="GOA:D7BWH3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH3"
FT                   /protein_id="ADI03329.1"
FT                   /translation="MSSYVLPQPRVAIAFHSGYGHTAVLAEAVRRGAEKAGAHVALIPV
FT                   DTITDEQWSELDAADALIFGTPTYMGGASAGFHAFAEATGGRFVDGTWADKIAAGFTNS
FT                   ASKSGDKLNTLTFLSAFAAQHRMIWVTLGLAPGWNALEASEHDLNRLGFWIGAGASTPQ
FT                   DGGIDTVHSSDIATAEHLGARVAERTAVFVAGRAALAGSADA"
     MSSYVLPQPR VAIAFHSGYG HTAVLAEAVR RGAEKAGAHV ALIPVDTITD EQWSELDAAD        60
     ALIFGTPTYM GGASAGFHAF AEATGGRFVD GTWADKIAAG FTNSASKSGD KLNTLTFLSA       120
     FAAQHRMIWV TLGLAPGWNA LEASEHDLNR LGFWIGAGAS TPQDGGIDTV HSSDIATAEH       180
     LGARVAERTA VFVAGRAALA GSADA                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page