(data stored in ACNUC7421 zone)

EMBL: CP002047.PE21

CP002047.PE21        Location/Qualifiers
FT   CDS             complement(18929..19402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03142"
FT                   /db_xref="InterPro:IPR025459"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW5"
FT                   /protein_id="ADI03142.1"
FT                   /translation="MSLRQYVYFALFSERTSAHEMTSQLGISPDEVSVRGSRFTKPTVN
FT                   PVSHCWTIVCRRPHLRVDEQIARTLDRLRPHTSHIAEAAGRLAADGGGAVLQVVRYFND
FT                   TDQHASDAPNPFGRRLDRDALDFLTAVGAGKLVTRPAGDWPPMPACGPCTRTA"
     MSLRQYVYFA LFSERTSAHE MTSQLGISPD EVSVRGSRFT KPTVNPVSHC WTIVCRRPHL        60
     RVDEQIARTL DRLRPHTSHI AEAAGRLAAD GGGAVLQVVR YFNDTDQHAS DAPNPFGRRL       120
     DRDALDFLTA VGAGKLVTRP AGDWPPMPAC GPCTRTA                                157
//

If you have problems or comments...

PBIL Back to PBIL home page