(data stored in ACNUC7421 zone)

EMBL: CP002047.PE210

CP002047.PE210       Location/Qualifiers
FT   CDS             229695..231095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00210"
FT                   /product="hypothetical protein"
FT                   /note="COG0142 Geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03331"
FT                   /db_xref="GOA:D7BWH5"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH5"
FT                   /protein_id="ADI03331.1"
FT                   /translation="MIDDAQVRRGRSTTNAKYGDAIALLTGDYLLARCMQAAASLGASP
FT                   MMSMAETLIDVCVGQMLESSQLFDPLRTEEDYLTAVSGKTARLMRTATTMGALQCNASN
FT                   DVQDALESFGHNLGMAFQIWDDILDICSEETGKQVAKDLLNGVYTLPVIYAIEDFPDRL
FT                   LPTLCEQPLSADRCQEILSLIHESGAISRAADVAQRHVTDALRAVESHPSFVHRAPIIG
FT                   RYLRSLVDRLASQHPALRAQPGTARSGTARSGTARSDSEALPSYGATKALIHDWLNGYI
FT                   TQPNDQLGRDGAVCPFVAPSLRAGSLEIRVRTVGPAPVVGTVIDMVRHALDEFDLIEWE
FT                   GSNPALRSLLVAMPDLAPAECHLLDETHRAVKSAAVRQGMMIGQFHPLCEVPTVRNPEF
FT                   PVNRSPVPLVAIRPMALHDVLFLKDRKEWFEEYHRRFGSHYKPSRGAIEPLLVELFQRA
FT                   CTEHGVGA"
     MIDDAQVRRG RSTTNAKYGD AIALLTGDYL LARCMQAAAS LGASPMMSMA ETLIDVCVGQ        60
     MLESSQLFDP LRTEEDYLTA VSGKTARLMR TATTMGALQC NASNDVQDAL ESFGHNLGMA       120
     FQIWDDILDI CSEETGKQVA KDLLNGVYTL PVIYAIEDFP DRLLPTLCEQ PLSADRCQEI       180
     LSLIHESGAI SRAADVAQRH VTDALRAVES HPSFVHRAPI IGRYLRSLVD RLASQHPALR       240
     AQPGTARSGT ARSGTARSDS EALPSYGATK ALIHDWLNGY ITQPNDQLGR DGAVCPFVAP       300
     SLRAGSLEIR VRTVGPAPVV GTVIDMVRHA LDEFDLIEWE GSNPALRSLL VAMPDLAPAE       360
     CHLLDETHRA VKSAAVRQGM MIGQFHPLCE VPTVRNPEFP VNRSPVPLVA IRPMALHDVL       420
     FLKDRKEWFE EYHRRFGSHY KPSRGAIEPL LVELFQRACT EHGVGA                      466
//

If you have problems or comments...

PBIL Back to PBIL home page