(data stored in ACNUC7421 zone)

EMBL: CP002047.PE211

CP002047.PE211       Location/Qualifiers
FT   CDS             231092..231946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00211"
FT                   /product="hypothetical protein"
FT                   /note="COG0657 Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03332"
FT                   /db_xref="GOA:D7BWH6"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH6"
FT                   /protein_id="ADI03332.1"
FT                   /translation="MSNGNGYRGFSRADLDREYSPSSVVPSLPFYLNEYATLSAAAHNE
FT                   HTPLTDLRYSASPEARLDLFPVEGGASALEVFVHGGYWQDVTKEQSAFAAPDFVAEGIA
FT                   FAALDYGLAPAYSLDEIVTMVCEAVAWLHANAPRFGIDPQRIHLSGSSAGAHLVAMALI
FT                   RDDAQRIAGATLLSGIYDLEPLRHTYVNGALGLDADAALRNSPIHHLPERLPPIVIARG
FT                   GGETGEFIRQHDTMAALLRRRNAVTELVCPTRNHFDLPYDLGNQHTALGKAVLTRIDDI
FT                   EEG"
     MSNGNGYRGF SRADLDREYS PSSVVPSLPF YLNEYATLSA AAHNEHTPLT DLRYSASPEA        60
     RLDLFPVEGG ASALEVFVHG GYWQDVTKEQ SAFAAPDFVA EGIAFAALDY GLAPAYSLDE       120
     IVTMVCEAVA WLHANAPRFG IDPQRIHLSG SSAGAHLVAM ALIRDDAQRI AGATLLSGIY       180
     DLEPLRHTYV NGALGLDADA ALRNSPIHHL PERLPPIVIA RGGGETGEFI RQHDTMAALL       240
     RRRNAVTELV CPTRNHFDLP YDLGNQHTAL GKAVLTRIDD IEEG                        284
//

If you have problems or comments...

PBIL Back to PBIL home page