(data stored in ACNUC7421 zone)

EMBL: CP002047.PE214

CP002047.PE214       Location/Qualifiers
FT   CDS             234067..235137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00214"
FT                   /product="O-methyltransferase family protein"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00214"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03335"
FT                   /db_xref="GOA:D7BWH9"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH9"
FT                   /protein_id="ADI03335.1"
FT                   /translation="MTAKSPLTKDDLVGILFGAGAFQMLHAGCELGLFRLLRRRPALSP
FT                   SQVAKELGLHARPVQILLLGTTALGLTARTDGRYRNGELVEELFQEGTWDIIEDLAEFQ
FT                   QKVTGPAALDFVASLRQNTNVGLRHIPGDGDDLYRRLTGHPQLSQLFYRCMKSWSTLSN
FT                   PILVENADLSGVGNVLDVGGGDGVNSIALAMANPGVAFTVFDLPGTAAIAQHKIRLQGL
FT                   SDRVGVVEGDMFADPFPTGHDCLLFANQLVIWSPEENRSLLRKAYEALPDGGRVLIFSA
FT                   MSDDTGDGPLYAALDNVYFATLPTGNSMIYHWAQYEEWLAEAGFCEVVRLPGKTWTPHG
FT                   LIAARKRMPSAPGGVK"
     MTAKSPLTKD DLVGILFGAG AFQMLHAGCE LGLFRLLRRR PALSPSQVAK ELGLHARPVQ        60
     ILLLGTTALG LTARTDGRYR NGELVEELFQ EGTWDIIEDL AEFQQKVTGP AALDFVASLR       120
     QNTNVGLRHI PGDGDDLYRR LTGHPQLSQL FYRCMKSWST LSNPILVENA DLSGVGNVLD       180
     VGGGDGVNSI ALAMANPGVA FTVFDLPGTA AIAQHKIRLQ GLSDRVGVVE GDMFADPFPT       240
     GHDCLLFANQ LVIWSPEENR SLLRKAYEAL PDGGRVLIFS AMSDDTGDGP LYAALDNVYF       300
     ATLPTGNSMI YHWAQYEEWL AEAGFCEVVR LPGKTWTPHG LIAARKRMPS APGGVK           356
//

If you have problems or comments...

PBIL Back to PBIL home page