(data stored in ACNUC7421 zone)

EMBL: CP002047.PE219

CP002047.PE219       Location/Qualifiers
FT   CDS             239330..239755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00219"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03340"
FT                   /db_xref="GOA:D7BWI4"
FT                   /db_xref="InterPro:IPR021362"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWI4"
FT                   /protein_id="ADI03340.1"
FT                   /translation="MRGRDRALCLFYGLFTVGGFLVMASMAVAYVLNHRENGPSGVVRD
FT                   FLRDAVTNAASRFIYADLTLVWIALAGFMVVEARRLGIRYVWSYIIGAPVLALCVSFPL
FT                   FMFIRQLKIASAAKGAPSPSPSVRLSAGLQEKGSDDH"
     MRGRDRALCL FYGLFTVGGF LVMASMAVAY VLNHRENGPS GVVRDFLRDA VTNAASRFIY        60
     ADLTLVWIAL AGFMVVEARR LGIRYVWSYI IGAPVLALCV SFPLFMFIRQ LKIASAAKGA       120
     PSPSPSVRLS AGLQEKGSDD H                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page