(data stored in ACNUC7421 zone)

EMBL: CP002047.PE22

CP002047.PE22        Location/Qualifiers
FT   CDS             20147..20485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00022"
FT                   /product="hypothetical protein"
FT                   /note="COG3795 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00022"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03143"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW6"
FT                   /protein_id="ADI03143.1"
FT                   /translation="MTRYLISFDDGAMTFPEEELPEVAEASLEVVRKARDAAVWVFGGG
FT                   LERQQASVVSTDGTVTNGPYPETKAVLGGFAIIDVPSREDALEWAAKIAAACRCAQEVR
FT                   EIMADPTV"
     MTRYLISFDD GAMTFPEEEL PEVAEASLEV VRKARDAAVW VFGGGLERQQ ASVVSTDGTV        60
     TNGPYPETKA VLGGFAIIDV PSREDALEWA AKIAAACRCA QEVREIMADP TV               112
//

If you have problems or comments...

PBIL Back to PBIL home page