(data stored in ACNUC7421 zone)

EMBL: CP002047.PE221

CP002047.PE221       Location/Qualifiers
FT   CDS             241685..243181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00221"
FT                   /product="hypothetical protein"
FT                   /note="COG3349 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03342"
FT                   /db_xref="GOA:D7BWI6"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWI6"
FT                   /protein_id="ADI03342.1"
FT                   /translation="MTGVTVIGGGLAGMTAAWTIRKLGVPVRLLEAAPELGGMAGSRVI
FT                   GNRVEDHGVHIFPAWYGNALRLVEELSIVDNLRECDNFYQLMPGEFPTFRTFRSLFTLG
FT                   DFVKDIRSGVTPAADRLLFYYGLIDLLAQRYEGRDESLHGFLHSRWYLTDTAIADIEHL
FT                   FVASSAAESQAASAASFRGSIAAFSRQPGRVRMPKGDLDTWFIGPFRRRLEADGVEVRT
FT                   GVELLEVSVDGDRLGTITLCDGDTVIEEVNGHVVLAVPHGRLSGLGRAVTRALRPPHGV
FT                   DELCSRPLGALHVYLRRRLPGLPDEHIRLVGSRHAITLIDVGQVWEGHRTTLLNCVVGR
FT                   VARLAELSEAEAVKVLVEELMGYLPVLTWDDIEHVCYQPHFAEPFFAPGPGSDQYRPVS
FT                   STALANLHIAGDFCAAPAGVAGMEGAVRSGLAAAESVRRALRPDAPRVRIDDIGTVSPS
FT                   AARGLRVALAPVAAAVRLLAKRPRGRGAAATAGHDLDGQP"
     MTGVTVIGGG LAGMTAAWTI RKLGVPVRLL EAAPELGGMA GSRVIGNRVE DHGVHIFPAW        60
     YGNALRLVEE LSIVDNLREC DNFYQLMPGE FPTFRTFRSL FTLGDFVKDI RSGVTPAADR       120
     LLFYYGLIDL LAQRYEGRDE SLHGFLHSRW YLTDTAIADI EHLFVASSAA ESQAASAASF       180
     RGSIAAFSRQ PGRVRMPKGD LDTWFIGPFR RRLEADGVEV RTGVELLEVS VDGDRLGTIT       240
     LCDGDTVIEE VNGHVVLAVP HGRLSGLGRA VTRALRPPHG VDELCSRPLG ALHVYLRRRL       300
     PGLPDEHIRL VGSRHAITLI DVGQVWEGHR TTLLNCVVGR VARLAELSEA EAVKVLVEEL       360
     MGYLPVLTWD DIEHVCYQPH FAEPFFAPGP GSDQYRPVSS TALANLHIAG DFCAAPAGVA       420
     GMEGAVRSGL AAAESVRRAL RPDAPRVRID DIGTVSPSAA RGLRVALAPV AAAVRLLAKR       480
     PRGRGAAATA GHDLDGQP                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page