(data stored in ACNUC7421 zone)

EMBL: CP002047.PE224

CP002047.PE224       Location/Qualifiers
FT   CDS             complement(244785..245873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00224"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03345"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWI9"
FT                   /protein_id="ADI03345.1"
FT                   /translation="MDARYRAVFTDLRTDQAIDVLPLQGVEYDDYLGKPGSLSATLPVP
FT                   DARMARRVRELVEGRTAVYLERGDEVCWGGIVWTLTPATDDRGSTTVGLQAATFDSYAG
FT                   RRYIRANLNFSAVDHLEIVRGLWEYMQGAEGGRIGVEYETTAPTTSRTVAYRDGDETLV
FT                   EEAIGQLAAMEPGFEYRIAVYRDPVTGRRVKLLQLGSPKIQAGSQPVMLDLPGDVLSYA
FT                   FPRDATRGGTTTRARGGTPGGGASGPVLSGEQVAQDLIAAGFPRLDTTSDHSNVTDRAT
FT                   LDAFARSELAALRGPVVIPSVRIRLGSDTTPALLGTTVRLRIKDVWFSEGLDARYRVVG
FT                   IKVTAPERGRPETADLYLEETD"
     MDARYRAVFT DLRTDQAIDV LPLQGVEYDD YLGKPGSLSA TLPVPDARMA RRVRELVEGR        60
     TAVYLERGDE VCWGGIVWTL TPATDDRGST TVGLQAATFD SYAGRRYIRA NLNFSAVDHL       120
     EIVRGLWEYM QGAEGGRIGV EYETTAPTTS RTVAYRDGDE TLVEEAIGQL AAMEPGFEYR       180
     IAVYRDPVTG RRVKLLQLGS PKIQAGSQPV MLDLPGDVLS YAFPRDATRG GTTTRARGGT       240
     PGGGASGPVL SGEQVAQDLI AAGFPRLDTT SDHSNVTDRA TLDAFARSEL AALRGPVVIP       300
     SVRIRLGSDT TPALLGTTVR LRIKDVWFSE GLDARYRVVG IKVTAPERGR PETADLYLEE       360
     TD                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page