(data stored in ACNUC7421 zone)

EMBL: CP002047.PE225

CP002047.PE225       Location/Qualifiers
FT   CDS             complement(245879..246922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03346"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ0"
FT                   /protein_id="ADI03346.1"
FT                   /translation="MTVRSAWHLPTGQTREDTRLAVGLGMASAGPLLTRAGCVFGGLQL
FT                   AGTAAAGMQAKLSPGQVWIAGTSTGSQGGYPVTVDSDTLLTITDGHASLPRVDALVVRV
FT                   YDNDYDGLGRYEATLELLQGTPAGSPTAPAVPKNTELLYEIAVPAGASAAKGITWASAI
FT                   TDRRRYTAALGGIVPAAGGAPHNGAYVGQYRDVGGRLERWDGVQWTKFIPNAVLMHTAD
FT                   WGGTTSTSYVEVLPIDTTAPLVATFTAPASRWVSLTFGAFTGADGDATAYISFRIRLQS
FT                   GTEVLAPSDDRAAILVGAGKASISTCFPVGNLTPGAVYTATAAYRSSVAGTRVHFDSRF
FT                   IRVDPVA"
     MTVRSAWHLP TGQTREDTRL AVGLGMASAG PLLTRAGCVF GGLQLAGTAA AGMQAKLSPG        60
     QVWIAGTSTG SQGGYPVTVD SDTLLTITDG HASLPRVDAL VVRVYDNDYD GLGRYEATLE       120
     LLQGTPAGSP TAPAVPKNTE LLYEIAVPAG ASAAKGITWA SAITDRRRYT AALGGIVPAA       180
     GGAPHNGAYV GQYRDVGGRL ERWDGVQWTK FIPNAVLMHT ADWGGTTSTS YVEVLPIDTT       240
     APLVATFTAP ASRWVSLTFG AFTGADGDAT AYISFRIRLQ SGTEVLAPSD DRAAILVGAG       300
     KASISTCFPV GNLTPGAVYT ATAAYRSSVA GTRVHFDSRF IRVDPVA                     347
//

If you have problems or comments...

PBIL Back to PBIL home page