(data stored in ACNUC7421 zone)

EMBL: CP002047.PE226

CP002047.PE226       Location/Qualifiers
FT   CDS             complement(247020..247943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00226"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03347"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ1"
FT                   /protein_id="ADI03347.1"
FT                   /translation="MASETTTAAAEPGPLITADGQVQWAGLLMGPGTDYWIAAEGLTGW
FT                   EELPALDTSDADRPVGHGGWPGSQWAQARTVTAQVWFAPDPDSGPEGVREALRALRAAT
FT                   AVRDEEEWLAVRLHGETLAVRARVTQRVVPTDRQFAASRLAKMTLQWKASDPRRYEAVG
FT                   RRDTVGLPQREPGLTWPLVWPLVWGAPGATGDLTVENDGSAPAHPVITFTGPCTRPRLA
FT                   NRAGGDWLEYAIALAPDDELVVDTAEGTVMFNGTASRRHTAVPGSAPEESFTLPPGTSQ
FT                   LSFRAASGGGGGAPPPATIAWRRAEW"
     MASETTTAAA EPGPLITADG QVQWAGLLMG PGTDYWIAAE GLTGWEELPA LDTSDADRPV        60
     GHGGWPGSQW AQARTVTAQV WFAPDPDSGP EGVREALRAL RAATAVRDEE EWLAVRLHGE       120
     TLAVRARVTQ RVVPTDRQFA ASRLAKMTLQ WKASDPRRYE AVGRRDTVGL PQREPGLTWP       180
     LVWPLVWGAP GATGDLTVEN DGSAPAHPVI TFTGPCTRPR LANRAGGDWL EYAIALAPDD       240
     ELVVDTAEGT VMFNGTASRR HTAVPGSAPE ESFTLPPGTS QLSFRAASGG GGGAPPPATI       300
     AWRRAEW                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page