(data stored in ACNUC7421 zone)

EMBL: CP002047.PE227

CP002047.PE227       Location/Qualifiers
FT   CDS             complement(247945..249102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00227"
FT                   /product="hypothetical protein"
FT                   /note="COG5412 Phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00227"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03348"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ2"
FT                   /protein_id="ADI03348.1"
FT                   /translation="MSLLAALNRSSSALLRLKNGTGQTDTTVSKFARTATQAGGAVGRI
FT                   KDDVDKSANSMRTLQREANAAERSVAKSGRSMTTAGRGAATGGGLMGRMKTGLQGVTTA
FT                   QKGLNTAMKSNVFGAVMALLMPLIMKLVDMAMQSKTVQRIVQAAFRIVGQVIGSTMRVA
FT                   KQVVQATWDAIKVAFTVVLKVIWTVVKTYFNIYKTIITTVIHAIMAVIRPLLSFFSEKI
FT                   PAAFRATRNGIQHAFSGLAGVVRGAFSAVLGAVRGPLNGVIGLVNRAIGALNRVKVSVP
FT                   SWVPGIGGKSFGVNLPTIPTLAQGGIVLPRPGGTLALLAEAGQAEAVLPLNRLNALLAR
FT                   TGPAPGLAIAGKPGGGFVIEHYHEAPGASARQTAEDLMFLMKARG"
     MSLLAALNRS SSALLRLKNG TGQTDTTVSK FARTATQAGG AVGRIKDDVD KSANSMRTLQ        60
     REANAAERSV AKSGRSMTTA GRGAATGGGL MGRMKTGLQG VTTAQKGLNT AMKSNVFGAV       120
     MALLMPLIMK LVDMAMQSKT VQRIVQAAFR IVGQVIGSTM RVAKQVVQAT WDAIKVAFTV       180
     VLKVIWTVVK TYFNIYKTII TTVIHAIMAV IRPLLSFFSE KIPAAFRATR NGIQHAFSGL       240
     AGVVRGAFSA VLGAVRGPLN GVIGLVNRAI GALNRVKVSV PSWVPGIGGK SFGVNLPTIP       300
     TLAQGGIVLP RPGGTLALLA EAGQAEAVLP LNRLNALLAR TGPAPGLAIA GKPGGGFVIE       360
     HYHEAPGASA RQTAEDLMFL MKARG                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page