(data stored in ACNUC7421 zone)

EMBL: CP002047.PE228

CP002047.PE228       Location/Qualifiers
FT   CDS             complement(249126..249707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00228"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03349"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ3"
FT                   /protein_id="ADI03349.1"
FT                   /translation="MSIGEEATKVAVAVVASWLDRYWAGFQKKLHQEAMTLINSEANAL
FT                   KLEATAFKGEANLATYSFKVAGKDINLLELFQERRAEREAQQTIDGIKSSIAELKERVD
FT                   HLHDFVKQDVESPLKQLHSHVHQALTERINQAVNQAHRANSRLDALRTQVSRSAPQQQA
FT                   HIGNTRSFSEAAERINHLEARIDSLAQALG"
     MSIGEEATKV AVAVVASWLD RYWAGFQKKL HQEAMTLINS EANALKLEAT AFKGEANLAT        60
     YSFKVAGKDI NLLELFQERR AEREAQQTID GIKSSIAELK ERVDHLHDFV KQDVESPLKQ       120
     LHSHVHQALT ERINQAVNQA HRANSRLDAL RTQVSRSAPQ QQAHIGNTRS FSEAAERINH       180
     LEARIDSLAQ ALG                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page