(data stored in ACNUC7421 zone)

EMBL: CP002047.PE229

CP002047.PE229       Location/Qualifiers
FT   CDS             complement(249739..250128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00229"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03350"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ4"
FT                   /protein_id="ADI03350.1"
FT                   /translation="MEEHAEALEADLLRYYGVDLLDWHRETLSSRRLSVLVRHLPPDSA
FT                   FVRAREGEAAEWRLTDHLLAAVVDHLAIANWMYASVNRDEYADPPEAPVPVPRPGAGAA
FT                   GASDAPGPAATDRAPTAAELARFFG"
     MEEHAEALEA DLLRYYGVDL LDWHRETLSS RRLSVLVRHL PPDSAFVRAR EGEAAEWRLT        60
     DHLLAAVVDH LAIANWMYAS VNRDEYADPP EAPVPVPRPG AGAAGASDAP GPAATDRAPT       120
     AAELARFFG                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page