(data stored in ACNUC7421 zone)

EMBL: CP002047.PE231

CP002047.PE231       Location/Qualifiers
FT   CDS             complement(250504..251079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00231"
FT                   /product="hypothetical protein"
FT                   /note="COG4147 Predicted symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03352"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ6"
FT                   /protein_id="ADI03352.1"
FT                   /translation="MPGMNPNEIRVAGTGRILTAPLGTTVPADVSTAWAAAWKDLGYTS
FT                   TDGIKFNKKDKIDPVDTWQSVSPARFVYSDRDLTVKFQLLQLNEDTLPFFFGGDAVTET
FT                   AAGSKVYRYELDSEPKKDERMLGVEFADGDVIKYRFIIRRGQVTETEELQLTRTAAVRL
FT                   GVTFTALAVDNDTPLATWLMNDPAFAGS"
     MPGMNPNEIR VAGTGRILTA PLGTTVPADV STAWAAAWKD LGYTSTDGIK FNKKDKIDPV        60
     DTWQSVSPAR FVYSDRDLTV KFQLLQLNED TLPFFFGGDA VTETAAGSKV YRYELDSEPK       120
     KDERMLGVEF ADGDVIKYRF IIRRGQVTET EELQLTRTAA VRLGVTFTAL AVDNDTPLAT       180
     WLMNDPAFAG S                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page