(data stored in ACNUC7421 zone)

EMBL: CP002047.PE232

CP002047.PE232       Location/Qualifiers
FT   CDS             complement(251127..251534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00232"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03353"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ7"
FT                   /protein_id="ADI03353.1"
FT                   /translation="MTEPLVIFPDVERLVVEHLKNRPELAGVLVDNRTPPDFDGTQKAV
FT                   LVSRAGGVWVEDIHLDQPLVDLEVYGPDKPTAHTVATAARTALFTVRGTTFGTAFVTDI
FT                   TEVDGPRWLPDHLHAAASRYLSTARLSIRPA"
     MTEPLVIFPD VERLVVEHLK NRPELAGVLV DNRTPPDFDG TQKAVLVSRA GGVWVEDIHL        60
     DQPLVDLEVY GPDKPTAHTV ATAARTALFT VRGTTFGTAF VTDITEVDGP RWLPDHLHAA       120
     ASRYLSTARL SIRPA                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page