(data stored in ACNUC7421 zone)

EMBL: CP002047.PE233

CP002047.PE233       Location/Qualifiers
FT   CDS             complement(251701..251898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00233"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03354"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ8"
FT                   /protein_id="ADI03354.1"
FT                   /translation="MRTARAPEGALVTADLAALEVGVTPATIRKWVQLERLRPAGRQGK
FT                   AFLYRLEDVFAAERATRRRM"
     MRTARAPEGA LVTADLAALE VGVTPATIRK WVQLERLRPA GRQGKAFLYR LEDVFAAERA        60
     TRRRM                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page