(data stored in ACNUC7421 zone)

EMBL: CP002047.PE237

CP002047.PE237       Location/Qualifiers
FT   CDS             257696..257827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00237"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03358"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK2"
FT                   /protein_id="ADI03358.1"
FT                   /translation="MSQLFTTLLTKAAVAVLEALLMRLLVQLWNTFALRGRPVAAVA"
     MSQLFTTLLT KAAVAVLEAL LMRLLVQLWN TFALRGRPVA AVA                          43
//

If you have problems or comments...

PBIL Back to PBIL home page