(data stored in ACNUC7421 zone)

EMBL: CP002047.PE238

CP002047.PE238       Location/Qualifiers
FT   CDS             complement(257856..258875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00238"
FT                   /product="sugar kinase, ribokinase"
FT                   /note="COG0524 Sugar kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00238"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03359"
FT                   /db_xref="GOA:D7BWK3"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK3"
FT                   /protein_id="ADI03359.1"
FT                   /translation="MNGLVNPAAGHGATGEPTDGRLVLVGNAIVDLVMRVPALPERGGD
FT                   TVSQDTNLTTGGGFNVLTAARRLGLPTLYVGAHGTGPFGDRVRADLAREGIEMVLDRVA
FT                   EADTGFCVAFVDDGGERTFATSLGAEARLTEADATAVLAALRPGDMVQISGYGLAYPVN
FT                   GPILASLVARLPEHTRVSLDPGPLVDQIPQEVLAPVLARCDWVSCNQREGRLLTGLADP
FT                   YEGAAALAARLGPRTGVLLRADAAGCWLVPPGGEPLHLPGRRVTAVDSNGAGDAHTGAF
FT                   LAFLGHGLDPIAAAQGANAAAAFAVTRHGPATGPTFDELFDFLDGDPPAALLSAALRR"
     MNGLVNPAAG HGATGEPTDG RLVLVGNAIV DLVMRVPALP ERGGDTVSQD TNLTTGGGFN        60
     VLTAARRLGL PTLYVGAHGT GPFGDRVRAD LAREGIEMVL DRVAEADTGF CVAFVDDGGE       120
     RTFATSLGAE ARLTEADATA VLAALRPGDM VQISGYGLAY PVNGPILASL VARLPEHTRV       180
     SLDPGPLVDQ IPQEVLAPVL ARCDWVSCNQ REGRLLTGLA DPYEGAAALA ARLGPRTGVL       240
     LRADAAGCWL VPPGGEPLHL PGRRVTAVDS NGAGDAHTGA FLAFLGHGLD PIAAAQGANA       300
     AAAFAVTRHG PATGPTFDEL FDFLDGDPPA ALLSAALRR                              339
//

If you have problems or comments...

PBIL Back to PBIL home page