(data stored in ACNUC7421 zone)

EMBL: CP002047.PE239

CP002047.PE239       Location/Qualifiers
FT   CDS             complement(258872..260365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00239"
FT                   /product="putative transmembrane protein"
FT                   /note="COG1457 Purine-cytosine permease and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00239"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03360"
FT                   /db_xref="GOA:D7BWK4"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK4"
FT                   /protein_id="ADI03360.1"
FT                   /translation="MAASEKDRVGSVETRGIEPVPDTERHGHAGQMFWTWFAANISILG
FT                   LPLGAALVSFRGLNIWQAAVVAVLGSFGSFALVGALSIAGKRGGAPALTLSRAVFGVRG
FT                   NAGPTLVTWMSRLGWETINTTTAAFALLALLDVAFGIRRNTVLTVICLLVFIGCTLLIS
FT                   GLGHATIMWINRWASYVFGLLNLVVIGFLAATVDWGKVGHAPAGPVSAMVVGVGMIAAG
FT                   TGIGWANTGADYARYLPRRIPGGRLVAASAFGAGIPLVVLISLGSLLAAGEPDLASASD
FT                   PVSAINAMLPTWMSIPYLIAAFGGLLLSNHLSVYSAGLTMITLGIRVRRTLAVGLDVIV
FT                   TFAGGIYFILIAKDFYGPFITFLTLLAVPINAWVGVFAVDLIVRRSYDSAALMDVGRSS
FT                   RYWFRGGVAWAAMIAWAMAIVVGLLFTEASTSPTDVWFSGPLAHSWIGSNGLGWVVTLT
FT                   LSATVYALLRRLDGTVRQEAAGQRPQQQVLSAPATREIS"
     MAASEKDRVG SVETRGIEPV PDTERHGHAG QMFWTWFAAN ISILGLPLGA ALVSFRGLNI        60
     WQAAVVAVLG SFGSFALVGA LSIAGKRGGA PALTLSRAVF GVRGNAGPTL VTWMSRLGWE       120
     TINTTTAAFA LLALLDVAFG IRRNTVLTVI CLLVFIGCTL LISGLGHATI MWINRWASYV       180
     FGLLNLVVIG FLAATVDWGK VGHAPAGPVS AMVVGVGMIA AGTGIGWANT GADYARYLPR       240
     RIPGGRLVAA SAFGAGIPLV VLISLGSLLA AGEPDLASAS DPVSAINAML PTWMSIPYLI       300
     AAFGGLLLSN HLSVYSAGLT MITLGIRVRR TLAVGLDVIV TFAGGIYFIL IAKDFYGPFI       360
     TFLTLLAVPI NAWVGVFAVD LIVRRSYDSA ALMDVGRSSR YWFRGGVAWA AMIAWAMAIV       420
     VGLLFTEAST SPTDVWFSGP LAHSWIGSNG LGWVVTLTLS ATVYALLRRL DGTVRQEAAG       480
     QRPQQQVLSA PATREIS                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page