(data stored in ACNUC7421 zone)

EMBL: CP002047.PE24

CP002047.PE24        Location/Qualifiers
FT   CDS             complement(21098..21397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00024"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03145"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW8"
FT                   /protein_id="ADI03145.1"
FT                   /translation="MADVTSTLPRREGQGEGLLLVVDVVEETALYWDRLGALRGFSSVG
FT                   RSIGSPVAVGFVRILGPFEAGYEFTAYVLEQALAFLAAEEDVPRLLLPVVVLAP"
     MADVTSTLPR REGQGEGLLL VVDVVEETAL YWDRLGALRG FSSVGRSIGS PVAVGFVRIL        60
     GPFEAGYEFT AYVLEQALAF LAAEEDVPRL LLPVVVLAP                               99
//

If you have problems or comments...

PBIL Back to PBIL home page