(data stored in ACNUC7421 zone)

EMBL: CP002047.PE243

CP002047.PE243       Location/Qualifiers
FT   CDS             264103..265104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00243"
FT                   /product="hypothetical protein"
FT                   /note="COG4326 Sporulation control protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00243"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03364"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK8"
FT                   /protein_id="ADI03364.1"
FT                   /translation="MVFKRLLGSLGVGGPTVDTVLEGGPVRPGGPLSGQVHLKGGSSDF
FT                   EIEQITLELVARVEAEHEDGEHEGVIAFDRFTVGGGFRLAEGEHRSVPFSVHIPWETPV
FT                   TELYGQPLGVVMGVRTELEVKGAKDKGDLDQLTVGPLPAQEAVLEAFGQLGFGFKSADL
FT                   ELGHIGGTGQTLPFYQEIELAPAPQYAHAVNEIEVTFLAHPGGMEVVLEADKRGGLFSG
FT                   GHDALNRFTVSHDGVEHHDWNAEVDAWVRQLVDSHASHGHHGAPYGQGYAHHDGYGHEG
FT                   HGHEGHHRSGPSTGAVVAGVAAGVAVGVVGGIVAAEVVDEIGDAFEDEEEDD"
     MVFKRLLGSL GVGGPTVDTV LEGGPVRPGG PLSGQVHLKG GSSDFEIEQI TLELVARVEA        60
     EHEDGEHEGV IAFDRFTVGG GFRLAEGEHR SVPFSVHIPW ETPVTELYGQ PLGVVMGVRT       120
     ELEVKGAKDK GDLDQLTVGP LPAQEAVLEA FGQLGFGFKS ADLELGHIGG TGQTLPFYQE       180
     IELAPAPQYA HAVNEIEVTF LAHPGGMEVV LEADKRGGLF SGGHDALNRF TVSHDGVEHH       240
     DWNAEVDAWV RQLVDSHASH GHHGAPYGQG YAHHDGYGHE GHGHEGHHRS GPSTGAVVAG       300
     VAAGVAVGVV GGIVAAEVVD EIGDAFEDEE EDD                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page