(data stored in ACNUC7421 zone)

EMBL: CP002047.PE247

CP002047.PE247       Location/Qualifiers
FT   CDS             complement(272492..272875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00247"
FT                   /product="hypothetical protein"
FT                   /note="COG1733 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00247"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03368"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWL2"
FT                   /protein_id="ADI03368.1"
FT                   /translation="MVTKQFKGSSLDEADLRRADSLAREIFSDVANKWALLIIEMLGER
FT                   TLRFSELRDEVEGISHKMLTQNLRMLEHNGLVERTVYPTVPPRVEYTLTEPGRALRATV
FT                   DAMCAWTHQYLGHIETARHRFDG"
     MVTKQFKGSS LDEADLRRAD SLAREIFSDV ANKWALLIIE MLGERTLRFS ELRDEVEGIS        60
     HKMLTQNLRM LEHNGLVERT VYPTVPPRVE YTLTEPGRAL RATVDAMCAW THQYLGHIET       120
     ARHRFDG                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page