(data stored in ACNUC7421 zone)

EMBL: CP002047.PE248

CP002047.PE248       Location/Qualifiers
FT   CDS             272976..273383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00248"
FT                   /product="hypothetical protein"
FT                   /note="COG0251 Putative translation initiation inhibitor,
FT                   yjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00248"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03369"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWL3"
FT                   /protein_id="ADI03369.1"
FT                   /translation="MAITLVNPDGLPKIDVYRQVSIASGSKQIFIAGQVAWDAEGNTVG
FT                   EGDLTAQVEQCYLNIGTALAGVGGSFDDVAKLTVYVVDWTPDKMPALLEGISRAAAKLG
FT                   VTPTPPATLLGVAALDVPDHLVEIEATAILD"
     MAITLVNPDG LPKIDVYRQV SIASGSKQIF IAGQVAWDAE GNTVGEGDLT AQVEQCYLNI        60
     GTALAGVGGS FDDVAKLTVY VVDWTPDKMP ALLEGISRAA AKLGVTPTPP ATLLGVAALD       120
     VPDHLVEIEA TAILD                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page