(data stored in ACNUC7421 zone)

EMBL: CP002047.PE255

CP002047.PE255       Location/Qualifiers
FT   CDS             complement(282199..283320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00255"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="COG1171 Threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03376"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM0"
FT                   /protein_id="ADI03376.1"
FT                   /translation="MLENLSSPHALPWLVRPSARTWRCDPAPAEVRGFHATLPDYAPTS
FT                   LAELPELASELGVGRVFAKDESCRLGLPAFKALGASWAVHRTLAERAASGRAPGPVTLV
FT                   TATDGNHGRAVARTARLLGQHAHVFVPQGVHPQAVAAIAAERAEVTEIEGAYDEAVRLA
FT                   ARAAAAPDAVLVQDTAWPGYEQIPGWIVEGYSTLCAEIDEQLAAQGVADGPDLVSIPVG
FT                   VGSLAQAVITHYRSRPSGRAPALLSVEPEAAPCVLESLIRGAPVSVTTGKTTMAGLNCG
FT                   TPSSIAWPHLNGGLDAAVAIPDADSAHAAARLAALGVSSGPCGAATLAGLRAVLTGAGV
FT                   GERRTALGLGATSVVVLLSTEGAAANPHATTDR"
     MLENLSSPHA LPWLVRPSAR TWRCDPAPAE VRGFHATLPD YAPTSLAELP ELASELGVGR        60
     VFAKDESCRL GLPAFKALGA SWAVHRTLAE RAASGRAPGP VTLVTATDGN HGRAVARTAR       120
     LLGQHAHVFV PQGVHPQAVA AIAAERAEVT EIEGAYDEAV RLAARAAAAP DAVLVQDTAW       180
     PGYEQIPGWI VEGYSTLCAE IDEQLAAQGV ADGPDLVSIP VGVGSLAQAV ITHYRSRPSG       240
     RAPALLSVEP EAAPCVLESL IRGAPVSVTT GKTTMAGLNC GTPSSIAWPH LNGGLDAAVA       300
     IPDADSAHAA ARLAALGVSS GPCGAATLAG LRAVLTGAGV GERRTALGLG ATSVVVLLST       360
     EGAAANPHAT TDR                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page