(data stored in ACNUC7421 zone)

EMBL: CP002047.PE257

CP002047.PE257       Location/Qualifiers
FT   CDS             284471..284977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00257"
FT                   /product="hypothetical protein"
FT                   /note="COG2128 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00257"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03378"
FT                   /db_xref="GOA:D7BWM2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM2"
FT                   /protein_id="ADI03378.1"
FT                   /translation="METRSITAEVPMAPRMSEDPAKLVPELAEASAALFKLTGNGSVSR
FT                   STIGLVQLRAGQIVGSTYLTVLHTGFLHKAGESEERITSVASWQDSPYFTGAERAALAL
FT                   VEAVLQPSADGERVSDDLYAQAAEHYDPKALATLMFAIGQVNFFISVALIAKPMPGRSF
FT                   TDPWK"
     METRSITAEV PMAPRMSEDP AKLVPELAEA SAALFKLTGN GSVSRSTIGL VQLRAGQIVG        60
     STYLTVLHTG FLHKAGESEE RITSVASWQD SPYFTGAERA ALALVEAVLQ PSADGERVSD       120
     DLYAQAAEHY DPKALATLMF AIGQVNFFIS VALIAKPMPG RSFTDPWK                    168
//

If you have problems or comments...

PBIL Back to PBIL home page