(data stored in ACNUC7421 zone)

EMBL: CP002047.PE260

CP002047.PE260       Location/Qualifiers
FT   CDS             complement(285555..286811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00260"
FT                   /product="hypothetical protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03381"
FT                   /db_xref="GOA:D7BWM5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM5"
FT                   /protein_id="ADI03381.1"
FT                   /translation="MPAQVEDLPRSQAQRRVLIVLIAAQVFSGAGLAAGVTVGALLAQD
FT                   MLGSTSLAGLLGALSTAGSALAAVAVGRISQARGRRPGLAAGYLAGAIGSTGVIAAAVA
FT                   GSSVLLFAAMFVYGAGAATNLLARYAGADLAAPEYRARAVSTVLVATTLGGVVGPNLAA
FT                   PAGDVAHTLGIPRLTGLFLLSGAAYALAALVLAVWLRPDPLLLARTLEAARAAAAVARP
FT                   DEAGGRVRPTAGRRRAGVLMGALVMVVTQLVMVAIMTMTPVHMHDHGHGAAASGLVISI
FT                   HIGAMYLPAPLSGWLVDRYGRLTVAAAAALVLLVAGIVAANAPVGSAAVFAVALALLGV
FT                   GWSLGLVSSTAIITDAVPLATRARTQGLVDVSIAIAGATGGMASGLVVAGAGYPVLAVG
FT                   GGILALAIVPTVVVAARSR"
     MPAQVEDLPR SQAQRRVLIV LIAAQVFSGA GLAAGVTVGA LLAQDMLGST SLAGLLGALS        60
     TAGSALAAVA VGRISQARGR RPGLAAGYLA GAIGSTGVIA AAVAGSSVLL FAAMFVYGAG       120
     AATNLLARYA GADLAAPEYR ARAVSTVLVA TTLGGVVGPN LAAPAGDVAH TLGIPRLTGL       180
     FLLSGAAYAL AALVLAVWLR PDPLLLARTL EAARAAAAVA RPDEAGGRVR PTAGRRRAGV       240
     LMGALVMVVT QLVMVAIMTM TPVHMHDHGH GAAASGLVIS IHIGAMYLPA PLSGWLVDRY       300
     GRLTVAAAAA LVLLVAGIVA ANAPVGSAAV FAVALALLGV GWSLGLVSST AIITDAVPLA       360
     TRARTQGLVD VSIAIAGATG GMASGLVVAG AGYPVLAVGG GILALAIVPT VVVAARSR         418
//

If you have problems or comments...

PBIL Back to PBIL home page