(data stored in ACNUC7421 zone)

EMBL: CP002047.PE261

CP002047.PE261       Location/Qualifiers
FT   CDS             complement(286993..287766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00261"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /note="COG2220 Predicted Zn-dependent hydrolases of the
FT                   beta-lactamase fold"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03382"
FT                   /db_xref="GOA:D7BWM6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM6"
FT                   /protein_id="ADI03382.1"
FT                   /translation="MPTEQIPIRVFGGPTALFEYGGLRFLTDPTFDEPRDYHVPGGQLT
FT                   KTAPSSAAPADLGRIDVVLLSHDEHPDNLDDSGRALLADVPLTLTTPGGGQRLGEGAKG
FT                   LADWESIELDRPGGGTITVTGVPAVHGPGAREDVEPITGQVVGFVLTGENLPAVYVSGD
FT                   NASLDLVKEIAERLGPVDTAILFAGAPRFSVLFDGALIVLDSAQAAEAARILGARRVVP
FT                   VHYDSWAHFTEGRDELIAAFTDAGLLDRLDLGDRG"
     MPTEQIPIRV FGGPTALFEY GGLRFLTDPT FDEPRDYHVP GGQLTKTAPS SAAPADLGRI        60
     DVVLLSHDEH PDNLDDSGRA LLADVPLTLT TPGGGQRLGE GAKGLADWES IELDRPGGGT       120
     ITVTGVPAVH GPGAREDVEP ITGQVVGFVL TGENLPAVYV SGDNASLDLV KEIAERLGPV       180
     DTAILFAGAP RFSVLFDGAL IVLDSAQAAE AARILGARRV VPVHYDSWAH FTEGRDELIA       240
     AFTDAGLLDR LDLGDRG                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page